PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100118870121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HB-other
Protein Properties Length: 510aa    MW: 57216.1 Da    PI: 7.8419
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100118870121genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.5e-191469257
                                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                      Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                                  +kR   ++ q+++Le+++ +++yps++++ +LA+++gLte+qV+ WF+ rR+k+kk
  Ote100118870121|100118870121 14 KKRIVKSRAQVQALEKFYSEHKYPSESMKLQLAESIGLTEKQVSGWFCHRRIKDKK 69
                                  899***************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-21269IPR009057Homeodomain-like
SuperFamilySSF466899.41E-18972IPR009057Homeodomain-like
PROSITE profilePS5007117.0061070IPR001356Homeobox domain
SMARTSM003893.7E-191274IPR001356Homeobox domain
CDDcd000861.52E-161469No hitNo description
PfamPF000462.4E-161469IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MHPEDDNAHS EKNKKRIVKS RAQVQALEKF YSEHKYPSES MKLQLAESIG LTEKQVSGWF  60
CHRRIKDKKL MNGENHAAVR QDRSGGVIQD RGSGHRQDSC GSTKQGNDKN LDSREVESGR  120
LTSKEFSAAE VIYDDDNNYA GIYNHTNDAS SGSTSSLQDI PPNYQNGGPS DAVISRYLIP  180
KFQSDVKGVK TRPGPSGYLK VKGRLENPAI AAVKRQLGKH YLEDGPPLGV EFDPLPPGAF  240
ESSMQDPVEE NYHTGEYVCG SPDFSNVRQN SKFCKGSQYP TSMAFFNSEI DGTNLRTRNG  300
SDIPDNYIYQ RSRLKTPLSN SCSYYPRSNS SLEFTESPVR YGSGIRSREN EYGSRHKPAI  360
EVMTIDTVQN YSNLQAYGGK FREKRAESWS RKFNDASTRV ALREKTENES SSLTTKGNKY  420
HSSGDKRLRG EVDGRICNDQ LINEHQVQIP YKNDTIAKKR VSEEFPCQQL PKATLMVDNL  480
PHNYQVTRPA TEMPSSFSED EESGGTSSMD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080403.11e-177PREDICTED: uncharacterized protein LOC105163662 isoform X2
TrEMBLA0A022RAL21e-174A0A022RAL2_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34362242